1024- Amyloid β-Peptide 1-40 (human) #2

Amyloid β-Peptide 1-40 (human)

$320$576

Currency: AUD $

for bulk quantities, please contact us

Clear
SKU: N/A Category:

Product Description


 

Three letter code: H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH

One letter code: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

Counterion: ammonium        Molecular Mass: 4329.9        CAS # 131438-79-4

Summary: amyloidogenic peptide detected in plaques in the brains of Alzheimer’s disease patients.

Reference: Nussbaum, J. M. et al. (2013), Alzheimer disease, A tale of two prions, Prion, 7(1), 14–19.

Image: Vivekanandan, S. et al. (2011), A partially folded structure of amyloid-beta(1-40) in an aqueous environment, Biochem. Biophys. Res. Commun., 411, 312-316.

Additional Information

Pack Size

0.5 mg, 1 mg